ApoX Anti-Virus verdedigingsspray

Menu

Beste uitverkoop

FEBICO ApoX Anti-Virus Defense Spray Service Introductie

Far East Bio-Tec Co., Ltd. is Taiwan ApoX Anti-Virus Defence Spray leverancier en fabrikant met meer dan 40 jaar ervaring. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina (zowel biologisch gecertificeerd als natuurlijk) verkrijgbaar onder het merk Febico , ruw poeder, Febico , private labeling en OEM / ODM-diensten onze klanten hoogwaardige ApoX Anti-Virus Defense Spray productieservice . Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor dat aan de vraag van elke klant wordt voldaan.


ApoX Anti-Virus verdedigingsspray

Apo X is samengesteld met eigen extractie van onze unieke microalgen FEM-101. Wetenschappelijk bewezen onderzoeken bewijzen dat ApoX een "virale firewall" voor uw lichaam kan creëren om effectief te helpen beschermen tegen infecties van meerdere virussen. Apo X werkt alleen voor virussen, het zal een beschermend membraan op de huid creëren om de virusaanval te weerstaan. Ons wetenschappelijk bewezen dat ApoX zich tegen het virus kan verdedigen voor 99,9% en langdurige effectiviteit tot 24 uur.

Kindvriendelijke formule Anti Virus Spray / Cold Flu Spray / met 100% pure Spirulina groene algenextract tegen infectie van meerdere virussen

voordelen

  • 4 decennia professionele ervaringen in microalgentechnologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico merk Febico
  • ODM / OEM / aanpassing
  • Grondstoffen, bulkproducten, eindproducten en private labeling
  • Een verscheidenheid aan verpakkingstypes
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met tijdige levering

Producteigenschappen

  • 99,9% Vermijd virusaanval.
  • Langdurige effectiviteit tot 24 uur.
  • Natuurlijk en geen chemisch additief! Alcohol vrij!!! Chloride vrij !!!

Hoofdfuncties (indicatie)

  • Voorkom meerdere virussen, zoals de griep (griep A & griep B), Coxsackie A16, Enterovirus, Respiratory Syncytial Virus, Rotavirus, Adenovirus en Herpes-virus type 1,2.
  • Wetenschappelijk bewezen dat ApoX zich voor 99,9% tegen het virus kan verdedigen.
  • De effectiviteit van ApoX is maximaal 24 uur. Spuit het eenvoudig op telefoons, servies, toiletten, airconditioning, maskers, speelgoed en amusement om de invasie van virussen in ons lichaam te beperken. De reguliere toepassing biedt voortdurende antivirale bescherming.
  • ApoX wordt gewonnen uit onze unieke microalgen FEM-101, het is natuurlijk en kan dagelijks worden gebruikt zonder chemische toevoeging. Het is veilig om te gebruiken voor alle gezinsleden. In tegenstelling tot gewone ontsmettingsmiddelen zal ApoX de nuttige bacteriën op de huid niet doden.
Hoofdingredient: Water, microalgenextract (Arthrospira FEM-101)
verpakking: 60 ml / fles
Aanbevolen voor: 1. kinderen
2. Volwassenen met een zwak immuunsysteem
3. Pendelaars die dagelijks het openbaar vervoer nemen
4. Ouderen die ouder zijn dan 65 jaar

Bedrijfsoverzicht Video



gerelateerde producten
  • Apogen ® vloeibare tinctuur - Apogen ® tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Apogen - Apogen ® Apogen
    Apogen ® Apogen

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® zuigtabletten / 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten / 400 mg tabletten

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Probiotica Granulaat - Apogen ® Apogen
    Apogen ® Probiotica Granulaat

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen Kinderkorrels - Apogen Kinderkorrel
    Apogen Kinderkorrels

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Apogen kinderen - Apogen ® Kinderen kauwtabletten
    Apogen ® Apogen kinderen

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen Medical Publication
    Apogen Medical Publication

    Apogen wetenschappelijk aangetoond onderzoek bewijst dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen. Het onderzoek was gepatenteerd in de Verenigde Staten (Amerikaans patent 6346408) en Taiwanese patent (TW patent I 272947) en werd gepubliceerd in het Journal of Medical Virology 2003 70: 119-125). Vul het onderstaande formulier in om het Apogen Medical Publication-documentbestand te downloaden.



Lees meer Gezondheidsvoordelen & voedingsinformatie
  • Wat is Apogen
    Wat is Apogen ® Microalgeneiwit

    Apogen is geen medicijn. Het is een gepatenteerd voedingssupplement dat is geconcentreerd en gezuiverd van de eigen FEM-101 microalg, een gezonde blauwgroene alg die zo rijk is aan voedingsstoffen dat het vaak superfood wordt genoemd.


  • Natuurlijke griep remedie
    Natuurlijke remedies tegen verkoudheid en griep

    Apogen microalgeneiwit wordt gewonnen uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan orale slijmvliescellen beschermen, beschermende beschermingsfilms vormen en virusaanvallen voorkomen, waardoor het een natuurlijke remedie tegen virussen is en het immuunsysteem een ​​boost geeft.