Apogen ® Apogen kinderen

Menu

Beste uitverkoop

FEBICO Apogen ® Apogen service voor kinderen Inleiding

Far East Bio-Tec Co., Ltd. is Taiwan Apogen ® Children Chewables leverancier en fabrikant met meer dan 40 jaar ervaring. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina (zowel biologisch gecertificeerd als natuurlijk) verkrijgbaar onder het merk Febico , rauw poeder, Febico , private labeling en OEM / ODM-diensten onze klanten hoogwaardige Apogen Children Chewables productieservice. Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor dat aan de vraag van elke klant wordt voldaan.


Apogen ® Apogen kinderen

Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.

Toegevoegd met DHA voor optimale hersen- en oogontwikkeling en functie bij kinderen / Geschikt voor kinderen van 4-12 jaar / 100% Natuurlijk Spirulina extract Phycocyanine Producenten voor antivirussupplement

voordelen

  • 4 decennia professionele ervaringen in microalgentechnologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico merk Febico
  • ODM / OEM / aanpassing
  • Grondstoffen, bulkproducten, eindproducten en private labeling
  • Een verscheidenheid aan verpakkingstypes
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met tijdige levering

Producteigenschappen

  • Natuurlijke supplementen, gezonde firewall tegen griepvirussen en virale pathogenen
  • Uniek waterextract van FEBICO 's eigen microalgenstam FEM-101
  • FEBICO 's geavanceerde productietechnieken om bio-activiteit te behouden
  • Apogen wetenschappelijke studies werden gepubliceerd in het Journal of Medical Virology
  • Onderzoek en studies in samenwerking met medische topuniversiteiten en onderzoekscentrum in Taiwan naar de effectiviteit van belangrijke componenten die verschillende virussoorten kunnen remmen
  • Meerdere patenten ontvangen van de Verenigde Staten en Taiwan
  • Natuurlijk product zonder bijwerkingen

Hoofdfuncties (indicatie)

  • Apogen wetenschappelijk aangetoond onderzoek van Apogen blijkt dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen.
  • Apogen is een voedingsstof waarvan wetenschappelijk is aangetoond dat het een breed scala aan virussen blokkeert om cellen binnen te Apogen , waaronder griepvirus (Type A, Type B, H1N1), enterovirus (EV71), herpesvirus, knokkelkoorts, respiratoir syncytieel virus (RSV) en rotavirus.
  • DHA voor optimale oog- en hersenontwikkeling en functie.
  • Kauwvorm perfect voor kinderen met groeiende tanden.
  • Natuurlijk en kan dagelijks zonder bijwerkingen worden ingenomen.
  • Stimuleer het immuunsysteem van kinderen en creëer een gezondheidsfirewall ter bescherming tegen het influenzavirus.
  • Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
Hoofdingredient: Apogen ® gepatenteerde Microalgenextractie (APC, CPC, SGF, gesulfateerde polysaccharide, nucleïnezuur, peptide, aminozuren, mineralen), lactose, tomatenextractpoeder (Lycopeen), ARA, Microalgen (DHA), Gamma-linoleenzuur, melkpoeder
verpakking: 0,95 g / tablet; 80 g per fles
Aanbevolen voor: Kinderen van drie tot twaalf (3-12) jaar oud
Aanbevolen dosering: 1-3 tabletten, 3 maal daags
Aandacht: Kauw alstublieft voordat u doorslikt

Bedrijfsoverzicht Video



gerelateerde producten
  • ApoX Anti-Virus verdedigingsspray - ApoX virale verdedigingsspray
    ApoX Anti-Virus verdedigingsspray

    Apo X is samengesteld met eigen extractie van onze unieke microalgen FEM-101. Wetenschappelijk bewezen onderzoeken bewijzen dat ApoX een "virale firewall" voor uw lichaam kan creëren om effectief te helpen beschermen tegen infecties van meerdere virussen. Apo X werkt alleen voor virussen, het zal een beschermend membraan op de huid creëren om de virusaanval te weerstaan. Ons wetenschappelijk bewezen dat ApoX zich tegen het virus kan verdedigen voor 99,9% en langdurige effectiviteit tot 24 uur.


  • Apogen ® vloeibare tinctuur - Apogen ® tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Apogen - Apogen ® Apogen
    Apogen ® Apogen

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® zuigtabletten / 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten / 400 mg tabletten

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Probiotica Granulaat - Apogen ® Apogen
    Apogen ® Probiotica Granulaat

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen Kinderkorrels - Apogen Kinderkorrel
    Apogen Kinderkorrels

    Apogen ® is een unieke extractie van de gepatenteerde microalgenstam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus.


  • Apogen Medical Publication
    Apogen Medical Publication

    Apogen wetenschappelijk aangetoond onderzoek bewijst dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen. Het onderzoek was gepatenteerd in de Verenigde Staten (Amerikaans patent 6346408) en Taiwanese patent (TW patent I 272947) en werd gepubliceerd in het Journal of Medical Virology 2003 70: 119-125). Vul het onderstaande formulier in om het Apogen Medical Publication-documentbestand te downloaden.



Lees meer Gezondheidsvoordelen & voedingsinformatie
  • Wat is Apogen
    Wat is Apogen ® Microalgeneiwit

    Apogen is geen medicijn. Het is een gepatenteerd voedingssupplement dat is geconcentreerd en gezuiverd van de eigen FEM-101 microalg, een gezonde blauwgroene alg die zo rijk is aan voedingsstoffen dat het vaak superfood wordt genoemd.


  • Natuurlijke griep remedie
    Natuurlijke remedies tegen verkoudheid en griep

    Apogen microalgeneiwit wordt gewonnen uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan orale slijmvliescellen beschermen, beschermende beschermingsfilms vormen en virusaanvallen voorkomen, waardoor het een natuurlijke remedie tegen virussen is en het immuunsysteem een ​​boost geeft.