Apogen ® Children Apogen


Beste verkoop

FEBICO Apogen ® Children Apogen Service Introductie

Far East Bio-Tec Co., Ltd. is Taiwan Apogen ® Children Apogen leverancier en fabrikant met meer dan 40 jaar ervaring. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina (beide biologisch gecertificeerd en natuurlijk) verkrijgbaar onder het merk Febico , rauwe poeder, Febico , private labeling en OEM / ODM-diensten onze klanten een hoogwaardige Apogen ® Children Apogen productiedienst aan. Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor de vraag van elke klant.

Apogen ® Children Apogen

Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

Toegevoegd met DHA voor een betere ontwikkeling van hersenen en ogen bij kinderen / Geschikt voor kinderen van 1-3 jaar


  • 4 decennia professionele ervaring in microalgentechnologie en -cultuur
  • 140.000 M2 productiesite met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door in-house en externe laboratoria


  • Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico van Febico
  • ODM / OEM / Maatwerk
  • Grondstoffen, bulkproducten, eindproducten en private labels
  • Een verscheidenheid aan keuzes van verpakkingen
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters voor testen
  • Service met tijdige levering


  • Natuurlijke supplementen, gezonde firewall tegen griepvirussen en virale pathogenen
  • Uniek water-extract van FEBICO 's gepatenteerde microalg-stam FEM-101
  • FEBICO 's geavanceerde productietechnieken om bio-activiteit te behouden
  • Wetenschappelijke studies van Apogen werden gepubliceerd in het Journal of Medical Virology
  • Onderzoek en studies uitgevoerd in samenwerking met de beste medische universiteiten en onderzoekscentra in Taiwan over de effectiviteit van belangrijke componenten die verschillende stammen van virussen kunnen remmen
  • Meerdere patenten ontvangen van de Verenigde Staten en Taiwan
  • Natuurlijk product zonder bijwerkingen

Belangrijke functies (indicatie)

  • Wetenschappelijk aangetoond onderzoek van Apogen bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen.

  • Apogen is een nutritioneel bestanddeel waarvan wetenschappelijk is aangetoond dat het een breed scala van virussen Apogen in cellen, waaronder influenzavirus (Type A, Type B, H1N1), enterovirus (EV71), herpesvirus, dengue-virus, respiratoir syncytieel virus (RSV) en rotavirus.

  • Ziekten behandelen of voorkomen, het is nog steeds een supplement, net zoals vitaminen, mineralen en andere voedingsstoffen, die een gezondheidsfirewall tegen het griepvirus creëren en kinderen helpen de griep te bestrijden.

  • Korrelvorm is speciaal gemengd voor veel smaak.

  • DHA voor optimale ontwikkeling en functie van ogen en hersenen.

  • Natuurlijk en kan dagelijks worden ingenomen zonder bijwerkingen.

  • Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
Hoofdingredient: Apogen ® gepatenteerde Microalgenextractie (APC, CPC, SGF, gesulfateerd polysaccharide, nucleïnezuur, peptide, aminozuren, mineralen), Lactose, Tomatenextractpoeder (Lycopene), ARA, Microalgen (DHA), Gamma-Linolenic zuur, melkpoeder
verpakking: 80 g / fles
Aanbevolen voor: Eén tot drie (1-3) éénjarige kinderen
Aanbevolen dosering: 2-3 theelepeltjes, 3-5 keer per dag voor kinderen ouder dan een jaar oud. Dit product kan direct worden geconsumeerd of inhoud aan water, melk of sap toevoegen (onder 50 ℃)
Aandacht: Vermijd vloeibare menging op hoge temperatuur (vloeistoftemperatuur moet lager zijn dan 50 ℃)

Bedrijfsoverzicht Video

gerelateerde producten
  • ApoX Anti-Virus Verdedigingsspray - ApoX virale verdedigingsspray
    ApoX Anti-Virus Verdedigingsspray

    Apo X is geformuleerd met gepatenteerde extractie van onze unieke microalg FEM-101. Wetenschappelijk onderbouwde onderzoeken bewijzen dat ApoX een 'virale firewall' voor uw lichaam kan creëren om effectief te helpen beschermen tegen infecties van meerdere virussen. Apo X werkt alleen voor virussen, het zal een beschermend membraan op de huid creëren om de virusaanval te weerstaan. Ons wetenschappelijk bewezen dat ApoX kan verdedigen tegen het virus voor 99,9% en langdurige effectiviteit tot 24 uur.

  • Apogen ® vloeibare tinctuur - Apogen ® tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® capsules - Apogen ® capsules
    Apogen ® capsules

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® zuigtabletten / 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten / 400 mg tabletten

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® Probiotica korrels - Apogen ® Apogen
    Apogen ® Probiotica korrels

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® Apogen kinderen - Apogen ® kinderen kauwbaar
    Apogen ® Apogen kinderen

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® medische publicatie
    Apogen ® medische publicatie

    Apogen wetenschappelijk aangetoond onderzoek bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen. Het onderzoek was gepatenteerd in de Verenigde Staten (VS-octrooi 6346408) en het Taiwanese octrooi (TW-octrooi I 272947) en werd gepubliceerd in Journal of Medical Virology 2003, 70: 119-125). Als u het Apogen ® Medical Publication-documentbestand wilt downloaden, vult u het onderstaande formulier in.

Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
  • Wat is Apogen
    Wat is Apogen ® Microalgen-eiwit

    Apogen is geen medicijn. Het is een gepatenteerd voedingssupplement dat is geconcentreerd en gezuiverd van de eigen stam FEM-101-microalgen, een gezonde blauwgroene algen die zo rijk aan voedingsstoffen is dat het gewoonlijk een superfood wordt genoemd.

  • Natuurlijke griep remedie
    Natuurlijke verkoudheids- en griepremedies

    Apogen microalgeneiwit wordt geëxtraheerd uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan orale mucosacellen beschermen, beschermende beschermingsfolies vormen en virusaanvallen voorkomen, wat het een natuurlijk middel tegen virussen maakt en het immuunsysteem stimuleert.