Apogen® Vloeibare Tinctuur

Beste verkoop

Apogen® Vloeibare Tinctuur | Leverancier van op microalgen gebaseerde grondstoffen en eindproducten |FEBICO

Gevestigd in Taiwan, Far East Bio-Tec Co., Ltd., sinds 1976, is een ISO-22000 en HACCP gecertificeerde Taiwanese fabrikant met meer dan 4 decennia ervaring in het produceren van op microalgen gebaseerde grondstoffen en afgewerkte producten, waaronder Chlorella, Spirulina, Chlorella Growth Factor CGF, gepatenteerd microalgenextract, Nattokinase, Probioticaen voedingssupplementen. Afgezien van het zoeken naar distributeurs van:FEBICO merkproducten, we bieden grondstoffen, afgewerkte producten, private labeling en OEM / ODM-services.

FEBICO is de eerste Naturland/EU Organic Certified Chlorella en Spirulina producent ter wereld en de eerste fabrikant ontvangt Organische Chlorellaonder de USDA-NOP-standaardcertificering. Daarnaast is het enige “Cracked Cell wall” patent verwerktChlorella in de wereld, zorgde voor 80% absorptie.

FEBICO biedt klanten hoogwaardige grondstoffen en eindproducten op basis van microalgen, beide met geavanceerde technologie en 40 jaar ervaring, FEBICO zorgt ervoor dat aan de eisen van elke klant wordt voldaan.


Apogen® Vloeibare Tinctuur

Apogen® is het volledig natuurlijke gezondheidssupplement op basis van een formule van microalgenextracten die een "firewall" voor de gezondheid in uw lichaam creëert.
Apogen is een voedingsstof waarvan wetenschappelijk is aangetoond dat deze voorkomt dat virussen cellen binnendringen.
Apogen's unieke voordelen en productiemethoden worden beschermd door Amerikaanse en internationale patenten en zijn onderworpen aan grondig wetenschappelijk onderzoek.
Apogenbestaat uit gezuiverde natuurlijke microalgeneiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003) en het Amerikaanse patent (US6346408) hebben aangetoond dat
Apogen is effectief in de strijd tegen enterovirus 71 en influenza A, B-infecties.


Apogen® Vloeibare Tinctuur is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties. De tinctuur (druppelvorm) is gunstig voor een snelle opname. Het is natuurlijk en kan dagelijks worden ingenomen zonder bijwerkingen.

Blauw
Spirulina Phycocyanine-supplementen, hoestsirooptinctuur, supplementen met natuurlijke ontstekingsremmende middelen, supplementen met kruidentincturen

Voordelen:

  • 4 decennia professionele ervaring in microalgentechnologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen >1000 ton
  • Innovatief en gespecialiseerd R&D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Distributeurs, groothandelaren of detailhandelaren zoeken voor: Febico merkproducten
  • ODM/OEM/ Aanpassing
  • Grondstoffen, bulkproducten, afgewerkte producten en private labeling
  • Een verscheidenheid aan verpakkingstypes
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met stipte levering

Producteigenschappen

  • Onderzoek en studies uitgevoerd in samenwerking met medische topuniversiteiten en onderzoekscentrum in Taiwan naar de effectiviteit van belangrijke componenten die verschillende virusstammen kunnen remmen
  • Natuurlijke supplementen, gezonde firewall voorkomen virale infecties en virale pathogenen
  • Uniek waterextract van FEBICO's gepatenteerde microalgenstam FEM-101 natuurlijk Spirulina
  • FEBICO's geavanceerde productietechnieken om bio-activiteit te behouden
  • Apogen wetenschappelijke studies werden gepubliceerd in het Journal of Medical Virology
  • Meerdere patenten ontvangen uit de Verenigde Staten en Taiwan
  • Natuurlijk product zonder bijwerkingen
  • Hoe werkt? Apogen® werken? Virussen verspreiden zich via neus en keel en komen vervolgens het menselijk lichaam binnen via het ademhalingssysteem. Het virus moet de hoofdingang van gezonde gastheercellen (menselijke cellen) openen en de kamer binnenkomen om zich voort te planten, om zich te gaan vermenigvuldigen. Echter, onzeApogen® zal cellen beschermen door een "virale firewall voor de gezondheid" te creëren waar veel virussen niet doorheen kunnen dringen. Daarom kunnen de virussen de hoofdingang van normale cellen niet openen en binnenkomen.

Belangrijkste functies

  • Apogen wetenschappelijk aangetoond onderzoek bewijst dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen.
  • Apogen is een voedingsstof waarvan wetenschappelijk is aangetoond dat het een breed scala aan virussen blokkeert om cellen binnen te dringen, waaronder het influenzavirus (Type A, Type B, H1N1), enterovirus (EV71), herpesvirus, denguevirus, respiratoir syncytieel virus (RSV) en rotavirus.
  • Apogen helpt het immuunsysteem te versterken.
  • Tinctuur (druppelvorm) is gunstig voor snelle absorptie.
  • Twee smaken: originele en mint smaken.
  • Natuurlijk en kan dagelijks worden ingenomen zonder bijwerkingen.
  • Lees meer gezondheidsvoordelen en voedingsinformatie
Hoofdingredient: Apogen® gepatenteerde microalgenextractie (APC, CPC, SGF, gesulfateerd polysacharide, nucleïnezuur, peptide, aminozuren, mineralen), oligosachariden, natuurlijk muntaroma
verpakkingen:30 ml/fles
Aanbevolen voor: 1. Personen ouder dan 1 jaar
2. Dagelijks supplement voor gezondheidsbescherming
Aanbevolen dosering: 1. Normale dosering: Druppel 1 ml onder de tong, voor kinderen wordt een halve dosering aanbevolen.
2. Verbeterde dosering: Druppel 2 ml onder de tong, driemaal per dag.
3. Kan worden gemengd met water
Aandacht:Om het product vers te houden, mag u de mond en speeksel niet aanraken wanneer u de druppelaar gebruikt.

Video



gerelateerde producten
  • ApoX Surface antivirale spray - Antivirale oppervlaktespray
    ApoX Surface antivirale spray

    FEBICOontwikkelt al 20 jaar antivirustechnologie, onderzoek heeft aangetoond dat ApoX-antivirale spray voor het oppervlak is samengesteld met gepatenteerde extractie van onze unieke mircoalgae FEM-101-algenstam, deze actieve ingrediënten door een beschermend membraan "virale firewall" op de huid te creëren om bestand zijn tegen de virusaanval en waar veel virussen niet doorheen kunnen dringen. Het kan de griepvirussen, enterovirussen, adenovirussen, ademhalingsvirussen en eenvoudig herpesvirus type I en type II effectief verhinderen om virusplaques te vormen, tot 24 uur lang.Febicopatenten ingediend voor ApoX oppervlakte-antivirale spray in toepassingen zoals maskers, telefoons, deurknoppen en andere plaatsen waar het publiek gemakkelijk met de handen bereikbaar is. ApoX antivirale oppervlaktespray in een diffusor kan op de omgeving worden gespoten om de virusgroei te remmen. ApoX vormt een beschermende laag en remt effectief de kans op infectie. Het is natuurlijk, veilig en bevat geen chemicaliën, het kan worden gebruikt voor mensen met een zwakke immuniteit, zoals kinderen of ouderen.


  • Apogen® Capsules - Immuunboostcapsule
    Apogen® Capsules

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).Apogen® Capsules is rijk aan vitamine C en B in microalgen, helpt het metabolisme van het lichaam en houdt het fysieke evenwicht. Het ingrediënt van Spirulina, knoflookextract en bijenpropolis om je immuunsysteem te ondersteunen. Het wordt aanbevolen voor mensen die langdurig op kantoor werken, vaak in de openbare ruimte verschijnen of hoge druk en vermoeidheid hebben.


  • Apogen® Zuigtabletten 400 mg tabletten - Blauw
Spirulina Tabletten extraheren
    Apogen® Zuigtabletten 400 mg tabletten

    Apogen® Tablets is het voedingssupplement dat wordt gewonnen uit de gepatenteerde stam FEM-101 microalgen, een gezonde blauwgroene alg. Het is rijk aan antioxidanten en ontstekingsremmende eiwitten, zoals allophycocyanine (APC), C-phycocyanine (CPC), dat Spirulinagroeifactor (SGF) en polysachariden voor het versterken van de immuniteit. Het fungeert als natuurlijke brandmuur tegen griepvirussen en virale ziekteverwekkers. ApogenTabletten bestaan ​​uit gezuiverde natuurlijke microalgeneiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003) en het Amerikaanse patent (US6346408) hebben aangetoond dat Apogen® is effectief in de strijd tegen enterovirus 71 en influenza A, B-infecties.Apogen® Zuigtabletten zorgen voor langzame afgifte en coating van Apogenin de mondholte om virale infecties te voorkomen. Onze Apogen® gepatenteerde extractie kan helpen een goede gezondheid te behouden en een evenwichtige voeding aan te passen. Het is geschikt voor dagelijks gebruik, vooral tijdens de uitbraak van COVID-19 en het griepseizoen.


  • Apogen® Lactobacillus Sporogenes
Probiotica Plus - Spirulina met
Probiotica
    Apogen® Lactobacillus Sporogenes Probiotica Plus

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen en initiële infecties. Door onze . toe te voegen Bacillus Coagulans, Sporenvormende Lactobacillus Sporogenes heeft een hoge weerstand tegen hitte en maagzuur. Unieke formulering bevat Lactobacillus acidophilus, Bifidobacterium bifidum, Lactobacillus casei die kunnen helpen Verhoogt het immuunsysteem, allergieën verminderen en de symptomen van het prikkelbare darm syndroom verbeteren. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).


  • Apogen® Kinderkorrels - Apogen Immuunondersteuning voor kinderen
    Apogen® Kinderkorrels

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).


  • Apogen® Kauwtabletten voor kinderen - Spirulina Immuunondersteuning voor kinderen extraheren
    Apogen® Kauwtabletten voor kinderen

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).Apogen® Children Chewables is perfect voor kinderen met groeiende tanden. Het ingrediënt van DHA is gunstig voor een optimale ontwikkeling en functie van ogen en hersenen. Het zal ook het immuunsysteem van kinderen stimuleren en een gezondheidsfirewall creëren om te beschermen tegen het griepvirus. Het wordt aanbevolen voor kinderen van drie tot twaalf (3-12 jaar).


  • Apogen® Medische publicatie - Tijdschrift voor klinische geneeskunde
    Apogen® Medische publicatie

    Apogenwetenschappelijk aangetoond onderzoek bewijst dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen. Het onderzoek werd gepatenteerd in de Verenigde Staten (Amerikaans patent 6346408) en Taiwanees patent (TW patent I 272947), en werd gepubliceerd in het Journal of Medical Virology 2003 70:119-125). Downloaden Apogen® Medisch publicatiedocumentbestand, vul dan het onderstaande formulier in.



Lees meer Gezondheidsvoordelen en voedingsinformatie
  • Apogen Microalgen Eiwit
    Wat is Apogen® Microalgenproteïne

  • AntiViral Remedy
    Natural Cold and Flu Remedies

    Apogen is a patented nutritional supplement concentrated and purified from proprietary strain Spirulina microalgae. A natural, healthy firewall and effective formula that medical virology has shown its antiviral properties.