Apogen ® Medische publicatie

Menu

Beste verkoop

Apogen ® Medische publicatie | Leverancier van grondstoffen en eindproducten op basis van microalgen | FEBICO

Far East Bio-Tec Co., Ltd. , gevestigd in Taiwan, is sinds 1976 een ISO-22000 en HACCP gecertificeerde Taiwanese fabrikant met meer dan 4 decennia ervaring in het produceren van op microalgen gebaseerde grondstoffen en eindproducten, waaronder Chlorella , Spirulina , Chlorella groeifactor CGF, gepatenteerd microalgenextract, Nattokinase , Probiotica en voedingssupplementen. Naast het zoeken naar distributeurs van FEBICO merkproducten, bieden we ook grondstoffen, afgewerkte producten, private labeling en OEM / ODM-services.

FEBICO is de eerste Naturland / EU Organic Certified Chlorella en Spirulina producent ter wereld en de eerste fabrikant ontvangt Organische Chlorella onder de USDA-NOP-standaardcertificering. Bovendien zorgde het enige octrooi met "Cracked Cell Wall" Chlorella ter wereld voor 80% absorptie.

FEBICO biedt klanten hoogwaardige op microalgen gebaseerde grondstoffen en eindproducten, beide met geavanceerde technologie en 40 jaar ervaring, FEBICO zorgt ervoor dat aan de eisen van elke klant wordt voldaan.


Apogen ® Medische publicatie

Apogen wetenschappelijk gedemonstreerd onderzoek bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen. Het onderzoek werd gepatenteerd in de Verenigde Staten (Amerikaans octrooi 6346408) en Taiwanees octrooi (TW-octrooi I 272947) en werd gepubliceerd in Journal of Medical Virology 2003 70: 119-125). Vul het onderstaande formulier in om het documentbestand van Apogen ® Medical Publication te downloaden.

Antivirale wetenschappelijke onderzoeken, Preventie van influenza-infecties

Voordelen

  • 4 decennia professionele ervaring in microalgen technologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaars of detailhandelaars voor Febico merk Febico
  • ODM / OEM / maatwerk
  • Grondstoffen, bulkproducten, afgewerkte producten en private labeling
  • Een verscheidenheid aan verpakkingstypen
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met tijdige levering

Producteigenschappen

  • Natuurlijke supplementen, gezonde firewall tegen griepvirussen en virale pathogenen
  • Uniek waterextract van FEBICO 's gepatenteerde microalgenstam FEM-101
  • FEBICO 's geavanceerde fabricagetechnieken om bioactiviteit te behouden
  • Apogen wetenschappelijke studies zijn gepubliceerd in het Journal of Medical Virology
  • Onderzoek en studies uitgevoerd in samenwerking met medische topuniversiteiten en onderzoekscentra in Taiwan naar de effectiviteit van sleutelcomponenten die verschillende virusstammen kunnen remmen
  • Meerdere patenten ontvangen uit de Verenigde Staten en Taiwan
  • Natuurlijk product zonder bijwerkingen

Bedrijfsoverzicht Video



gerelateerde producten
  • ApoX Surface Anti-Viral Spray - ApoX Surface Anti-Viral Spray
    ApoX Surface Anti-Viral Spray

    FEBICO ontwikkelt al 20 jaar antivirustechnologie, onderzoek heeft aangetoond dat ApoX-antivirale spray voor het oppervlak is samengesteld met gepatenteerde extractie van onze unieke mircoalgae FEM-101-algensoort, deze actieve ingrediënten door een beschermend membraan "virale firewall" op de huid te creëren om de virusaanval te weerstaan ​​en dat veel virussen er niet doorheen kunnen dringen. Het kan de influenzavirussen, enterovirussen, adenovirussen, ademhalingsvirussen en het eenvoudige herpesvirus type I en type II effectief tot 24 uur tegenhouden. Febico heeft patenten aangevraagd voor ApoX-antivirale spray voor oppervlakken in toepassingen zoals maskers, telefoons, deurknoppen en andere plaatsen die gemakkelijk met de hand toegankelijk zijn voor het publiek. ApoX-antivirale spray in een diffusor kan op de omgeving worden gespoten om de groei van virussen te remmen. ApoX vormt een beschermende laag en remt effectief de kans op infectie. Het is natuurlijk, veilig en bevat geen chemicaliën, het kan worden gebruikt voor mensen met een zwakke immuniteit zoals kinderen of ouderen.


  • Apogen ® vloeibare tinctuur - Apogen ® Tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een gepatenteerd eiwit dat is geëxtraheerd uit Spirulina dat een actieve stof bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen ® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens Apogen . Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen ® Apogen - Apogen ® Apogen
    Apogen ® Apogen

    Apogen ® is een gepatenteerd eiwit dat is geëxtraheerd uit Spirulina dat een actieve stof bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen ® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens Apogen . Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen ® zuigtabletten 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten 400 mg tabletten

    Apogen ® Tablets is het voedingssupplement gewonnen uit de gepatenteerde stam FEM-101 microalgen, een gezonde blauwgroene alg. Het bevat een overvloed aan antioxidanten en ontstekingsremmende eiwitten, namelijk Allophycocyanin (APC), C-phycocyanine (CPC), met Spirulina groeifactor (SGF) en polysacchariden voor het versterken van de immuniteit. Het werkt als een natuurlijke brandmuur tegen griepvirussen en virale pathogenen. Apogen tabletten bestaan ​​uit gezuiverde natuurlijke microalgen-eiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003) en US patent (US6346408) hebben aangetoond dat Apogen ® effectief is in de strijd tegen enterovirus 71 en influenza A, B infecties.


  • Apogen ® Lactobacillus Sporogenes Probiotica Plus - Apogen ® Lactobacillus Sporogenes Probiotica Plus
    Apogen ® Lactobacillus Sporogenes Probiotica Plus

    Apogen ® is een gepatenteerd eiwit dat is geëxtraheerd uit Spirulina dat een actieve stof bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen ® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens Apogen en initiële infecties. Door toevoeging van onze Bacillus Coagulans heeft Spore-vormende Lactobacillus Sporogenes een hoge weerstand tegen hitte en maagzuur. Unieke formulering bevat Lactobacillus acidophilus, Bifidobacterium bifidum, Lactobacillus casei die Verhoogt het immuunsysteem kunnen Verhoogt het immuunsysteem , allergieën kunnen verminderen en de symptomen van het prikkelbare darm syndroom kunnen verbeteren. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen ® Apogen kinderen - Apogen ® Children Granule
    Apogen ® Apogen kinderen

    Apogen ® is een gepatenteerd eiwit dat is geëxtraheerd uit Spirulina dat een actieve stof bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen ® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens Apogen . Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen ® Apogen kinderen - Apogen ® Children Chewable
    Apogen ® Apogen kinderen

    Apogen ® is een gepatenteerd eiwit dat is geëxtraheerd uit Spirulina dat een actieve stof bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen ® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens Apogen . Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).



Lees meer Gezondheidsvoordelen en voedingsinformatie
  • Apogen Microalgae Protein
    Wat is Apogen ® Microalgae Protein

  • AntiViral Remedy
    Natuurlijke remedies tegen verkoudheid en griep

    Apogen microalgen-eiwit wordt gewonnen uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan de mondslijmvliescellen beschermen, beschermfolies vormen en virusaanvallen voorkomen, wat het een natuurlijke remedie tegen virussen maakt en het immuunsysteem stimuleert.