Apogen ® capsules


Beste verkoop

FEBICO Apogen ® Capsules Service Introductie

Far East Bio-Tec Co., Ltd. (ALGAPHARMA BIOTECH CORP.) Is Taiwan Apogen ® Capsules leverancier en fabrikant met meer dan 40 jaar experence. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina , zowel biologisch gecertificeerd als natuurlijk verkrijgbaar in eindproducten, onbewerkt poeder, Apogen , private labeling en OEM / ODM-diensten, onze klanten een hoogwaardige Apogen ® Capsules productiedienst. Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor de vraag van elke klant.

Apogen ® capsules

Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

Samen met knoflookextract en bijenpropolis zijn het natuurlijke stoffen om ziekteverwekkers zoals bacteriën en andere kleine micro-organismen te bestrijden.


  • 4 decennia professionele ervaring in microalgentechnologie en -cultuur
  • 140.000 M2 productiesite met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Organische certificeringen: USDA-NOP, EU en Naturland Duitsland
  • Productveiligheid geverifieerd door in-house en externe laboratoria


Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico van Febico

ODM / OEM / aanpassen
Grondstoffen, bulkproducten, eindproducten en private labels
Een verscheidenheid aan keuzes van verpakkingen
Technische ondersteuning en grafisch ontwerp
Gratis monsters voor testen
Service met tijdige levering


  • Natuurlijke supplementen, gezonde firewall tegen griepvirussen en virale pathogenen
  • Uniek water-extract van FEBICO 's gepatenteerde microalg-stam FEM-101
  • Geavanceerde fabricagetechnieken om bio-activiteit te behouden
  • Wetenschappelijke studies werden gepubliceerd in het Journal of Medical Virology
  • Meerdere octrooien ontvangen van de Verenigde Staten (VS-octrooi nr. US6346408) en Taiwan
  • Natuurlijke formule zonder bijwerkingen

Belangrijke functies

  • Wetenschappelijk aangetoond onderzoek van Apogen bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen.
  • Apogen is een nutritioneel bestanddeel waarvan wetenschappelijk is aangetoond dat het een breed scala aan virussen Apogen in cellen, waaronder influenzavirus (Type A, Type B, H1N1), enterovirus (EV71), herpesvirus, dengue-virus, respiratoir syncytieel virus (RSV) en rotavirus.
  • Apogen bestaat uit gezuiverde, geconcentreerde natuurlijke microalgen-eiwitten en nucleotiden.
  • Rijke vitamine C en B in microalgen helpen het metabolisme van het lichaam en houden het fysieke evenwicht in stand.
  • Capsule bevat Spirulina , knoflookextract en bijenpropolis om je immuunsysteem te ondersteunen.
  • Apogen kan helpen om een ​​goede gezondheid te handhaven en een evenwichtige voeding aan te passen en kan dagelijks worden ingenomen zonder bijwerking.
Hoofdingredient: Apogen ® gepatenteerde Microalgenextractie (APC, CPC, SGF, gesulfateerd polysaccharide, nucleïnezuur, peptide, aminozuren, mineralen), Spirulina (vitamine B-complex), knoflookextract en bijenpropolis.
verpakking: 500 mg / capsule, 30 capsules / fles
Aanbevolen voor: 1. Kantoormedewerkers met een lange werkdag
2. Wordt vaak weergegeven in de openbare ruimte
3. Voedingssupplement voor ziekte
4. Hoge druk en vermoeidheid
Aanbevolen dosering: 1 capsule per dag, 2 capsules per dag tijdens infecties
Aandacht: 1. Niet aanbevolen voor baby
2. Raadpleeg uw arts als u zwanger bent of borstvoeding geeft
3. Dit product bevat propolis. Wees voorzichtig als u allergisch bent voor propolis

Bedrijfsoverzicht Video

gerelateerde producten
  • ApoX Anti-Virus Verdedigingsspray - ApoX virale verdedigingsspray
    ApoX Anti-Virus Verdedigingsspray

    Apo X is geformuleerd met gepatenteerde extractie van onze unieke microalg FEM-101. Wetenschappelijk onderbouwde onderzoeken bewijzen dat ApoX een 'virale firewall' voor uw lichaam kan creëren om effectief te helpen beschermen tegen infecties van meerdere virussen. Apo X werkt alleen voor virussen, het zal een beschermend membraan op de huid creëren om de virusaanval te weerstaan. Ons wetenschappelijk bewezen dat ApoX kan verdedigen tegen het virus voor 99,9% en langdurige effectiviteit tot 24 uur.

  • Apogen ® vloeibare tinctuur - Apogen ® tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® zuigtabletten / 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten / 400 mg tabletten

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® Probiotica korrels - Apogen ® Apogen
    Apogen ® Probiotica korrels

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® Children Apogen - Apogen ® Children Granule
    Apogen ® Children Apogen

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® Apogen kinderen - Apogen ® kinderen kauwbaar
    Apogen ® Apogen kinderen

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.

  • Apogen ® medische publicatie
    Apogen ® medische publicatie

    Apogen wetenschappelijk aangetoond onderzoek bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen. Het onderzoek was gepatenteerd in de Verenigde Staten (VS-octrooi 6346408) en het Taiwanese octrooi (TW-octrooi I 272947) en werd gepubliceerd in Journal of Medical Virology 2003, 70: 119-125). Als u het Apogen ® Medical Publication-documentbestand wilt downloaden, vult u het onderstaande formulier in.

Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
  • Wat is Apogen
    Wat is Apogen ® Microalgen-eiwit

    Apogen is geen medicijn. Het is een gepatenteerd voedingssupplement dat is geconcentreerd en gezuiverd van de eigen stam FEM-101-microalgen, een gezonde blauwgroene algen die zo rijk aan voedingsstoffen is dat het gewoonlijk een superfood wordt genoemd.

  • Natuurlijke griep remedie
    Natuurlijke verkoudheids- en griepremedies

    Apogen microalgeneiwit wordt geëxtraheerd uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan orale mucosacellen beschermen, beschermende beschermingsfolies vormen en virusaanvallen voorkomen, wat het een natuurlijk middel tegen virussen maakt en het immuunsysteem stimuleert.