Apogen ® medische publicatie

Menu

Beste verkoop

FEBICO Apogen ® medische publicatieservice Introductie

Far East Bio-Tec Co., Ltd. (ALGAPHARMA BIOTECH CORP.) Is Taiwan Apogen ® Medical Publication leverancier en fabrikant met meer dan 40 jaar ervaring. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina , zowel biologisch gecertificeerd als natuurlijk verkrijgbaar in eindproducten, onbewerkt poeder, Apogen , private labeling en OEM / ODM-diensten, onze klanten een hoogwaardige Apogen ® Medical Publication productiedienst. Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor de vraag van elke klant.


Apogen ® medische publicatie

Apogen wetenschappelijk aangetoond onderzoek bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen. Het onderzoek was gepatenteerd in de Verenigde Staten (VS-octrooi 6346408) en het Taiwanese octrooi (TW-octrooi I 272947) en werd gepubliceerd in Journal of Medical Virology 2003, 70: 119-125). Als u het Apogen ® Medical Publication-documentbestand wilt downloaden, vult u het onderstaande formulier in.

Onze wetenschappelijke studies tonen aan dat Apogen ® verdere voordelen biedt bij de bestrijding van enterovirus 71 en het effectief voorkomen van influenza A, B-infecties.

voordelen

  • 4 decennia professionele ervaring in microalgentechnologie en -cultuur
  • 140.000 M2 productiesite met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Organische certificeringen: USDA-NOP, EU en Naturland Duitsland
  • Productveiligheid geverifieerd door in-house en externe laboratoria

Diensten

Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico van Febico

ODM / OEM / aanpassen
Grondstoffen, bulkproducten, eindproducten en private labels
Een verscheidenheid aan keuzes van verpakkingen
Technische ondersteuning en grafisch ontwerp
Gratis monsters voor testen
Service met tijdige levering

Bedrijfsoverzicht Video



gerelateerde producten
  • ApoX Anti-Virus Verdedigingsspray - ApoX virale verdedigingsspray
    ApoX Anti-Virus Verdedigingsspray

    Apo X is geformuleerd met gepatenteerde extractie van onze unieke microalg FEM-101. Wetenschappelijk onderbouwde onderzoeken bewijzen dat ApoX een 'virale firewall' voor uw lichaam kan creëren om effectief te helpen beschermen tegen infecties van meerdere virussen. Apo X werkt alleen voor virussen, het zal een beschermend membraan op de huid creëren om de virusaanval te weerstaan. Ons wetenschappelijk bewezen dat ApoX kan verdedigen tegen het virus voor 99,9% en langdurige effectiviteit tot 24 uur.


  • Apogen ® vloeibare tinctuur - Apogen ® tinctuur
    Apogen ® vloeibare tinctuur

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® capsules - Apogen ® capsules
    Apogen ® capsules

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® zuigtabletten / 400 mg tabletten - Apogen ® zuigtabletten
    Apogen ® zuigtabletten / 400 mg tabletten

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Probiotica korrels - Apogen ® Apogen
    Apogen ® Probiotica korrels

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Children Apogen - Apogen ® Children Granule
    Apogen ® Children Apogen

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.


  • Apogen ® Apogen kinderen - Apogen ® kinderen kauwbaar
    Apogen ® Apogen kinderen

    Apogen ® is een unieke extractie van de gepatenteerde microalg-stam FEM-101, die actieve essentie-ingrediënten bevat, waaronder Allophycocyanin (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Het beschermt je tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en dengue-virus.



Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
  • Wat is Apogen
    Wat is Apogen ® Microalgen-eiwit

    Apogen is geen medicijn. Het is een gepatenteerd voedingssupplement dat is geconcentreerd en gezuiverd van de eigen stam FEM-101-microalgen, een gezonde blauwgroene algen die zo rijk aan voedingsstoffen is dat het gewoonlijk een superfood wordt genoemd.


  • Natuurlijke griep remedie
    Natuurlijke verkoudheids- en griepremedies

    Apogen microalgeneiwit wordt geëxtraheerd uit natuurlijke Spirulina . Het is oplosbaar in water, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan orale mucosacellen beschermen, beschermende beschermingsfolies vormen en virusaanvallen voorkomen, wat het een natuurlijk middel tegen virussen maakt en het immuunsysteem stimuleert.