ApoX Surface antivirale spray

Beste verkoop

ApoX Surface antivirale spray | Leverancier van op microalgen gebaseerde grondstoffen en eindproducten |FEBICO

Gevestigd in Taiwan, Far East Bio-Tec Co., Ltd., sinds 1976, is een ISO-22000 en HACCP gecertificeerde Taiwanese fabrikant met meer dan 4 decennia ervaring in het produceren van op microalgen gebaseerde grondstoffen en afgewerkte producten, waaronder Chlorella, Spirulina, Chlorella Growth Factor CGF, gepatenteerd microalgenextract, Nattokinase, Probioticaen voedingssupplementen. Afgezien van het zoeken naar distributeurs van:FEBICO merkproducten, we bieden grondstoffen, afgewerkte producten, private labeling en OEM / ODM-services.

FEBICO is de eerste Naturland/EU Organic Certified Chlorella en Spirulina producent ter wereld en de eerste fabrikant ontvangt Organische Chlorellaonder de USDA-NOP-standaardcertificering. Daarnaast is het enige “Cracked Cell wall” patent verwerktChlorella in de wereld, zorgde voor 80% absorptie.

FEBICO biedt klanten hoogwaardige grondstoffen en eindproducten op basis van microalgen, beide met geavanceerde technologie en 40 jaar ervaring, FEBICO zorgt ervoor dat aan de eisen van elke klant wordt voldaan.

ApoX Surface antivirale spray

FEBICOontwikkelt al 20 jaar antivirustechnologie, onderzoek heeft aangetoond dat ApoX-antivirale spray voor het oppervlak is samengesteld met gepatenteerde extractie van onze unieke mircoalgae FEM-101-algenstam, deze actieve ingrediënten door een beschermend membraan "virale firewall" op de huid te creëren om bestand zijn tegen de virusaanval en waar veel virussen niet doorheen kunnen dringen. Het kan de griepvirussen, enterovirussen, adenovirussen, ademhalingsvirussen en eenvoudig herpesvirus type I en type II effectief verhinderen om virusplaques te vormen, tot 24 uur lang.

Febicopatenten ingediend voor ApoX oppervlakte-antivirale spray in toepassingen zoals maskers, telefoons, deurknoppen en andere plaatsen waar het publiek gemakkelijk met de handen bereikbaar is. ApoX antivirale oppervlaktespray in een diffusor kan op de omgeving worden gespoten om de virusgroei te remmen. ApoX vormt een beschermende laag en remt effectief de kans op infectie. Het is natuurlijk, veilig en bevat geen chemicaliën, het kan worden gebruikt voor mensen met een zwakke immuniteit, zoals kinderen of ouderen.

Antivirusspray, Anti-infectiespray, Beste desinfecterende reinigingsmiddelen, Griepbestrijdende huishoudelijke reinigingsmiddelen, Natuurlijke antivirale reinigingsmiddelen


  • 4 decennia professionele ervaring in microalgentechnologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen >1000 ton
  • Innovatief en gespecialiseerd R&D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria


  • Distributeurs, groothandelaren of detailhandelaren zoeken voor: Febico merkproducten
  • ODM/OEM/ Aanpassing
  • Grondstoffen, bulkproducten, afgewerkte producten en private labeling
  • Een verscheidenheid aan verpakkingstypes
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met stipte levering


  • ApoX Surface antivirale spray wordt gewonnen uit onze unieke microalg FEM-101, het is natuurlijk en kan dagelijks worden gebruikt zonder chemische toevoegingen. Het is veilig te gebruiken voor alle gezinsleden. In tegenstelling tot gewone ontsmettingsmiddelen, zal ApoX de nuttige bacteriën op de huid niet doden.
  • ApoX Surface antivirale spray heeft het keurmerk "SNQ Symbol of National Quality" gekregen. SNQ Nationaal Keurmerk, staat voor "Veiligheid En Kwaliteit" en wordt uitgereikt in samenwerking met het Instituut voor Biotechnologie en Medicijnen Industrie (IBMI). De kwaliteitscommissie van IBMI bestaat uit 120 meest gezaghebbende wetenschappers en gekwalificeerde experts op het gebied van voedselveiligheid en biotechnologie. Om het SNQ National Quality Mark te verkrijgen, moet een product een langdurig en streng peer review-proces doorlopen, waarbij de veiligheid en effectiviteit worden getest. Het SNQ Nationaal Keurmerk betekent dat Apox Antiviral Spray gecertificeerd is als effectief en veilig.
  • Natuurlijke producten, geen chemische toevoegingen, alcoholvrij en chloridevrij, weekmakervrij en vrij van zware metalen.
  • Ontvangen bronzen medaille voor epidemisch preventieproduct bij Taiwan Symbol of National Quality.

Belangrijkste functies

  • Voorkom meerdere virussen, zoals de griep (griep A & griep B), Coxsackie A16, Enterovirus, Respiratory Syncytial Virus, Rotavirus, Adenovirus en Herpes-virus type 1,2.
  • Wetenschappelijk bewezen dat ApoX antivirale antivirale spray voor 99,9% bescherming biedt tegen de virusaanval.
  • De langdurige effectiviteit van ApoX antivirale oppervlaktespray is tot 24 uur. Spuit het gewoon op telefoons, servies, toiletten, airconditioning, maskers, speelgoed en amusementsfaciliteiten om de invasie van virussen in ons lichaam te beperken. De reguliere toepassing biedt continue antivirale bescherming.
Hoofdingredient:Water, Microalgenextract (Arthrospira FEM-101)
verpakkingen:30 ml/fles
Aanbevolen voor (alleen voor extern gebruik): 1. Kinderen
2. Volwassenen met een zwak immuunsysteem
3. Forenzen die dagelijks met het openbaar vervoer reizen
4. Ouderen ouder dan 65 jaar


gerelateerde producten
  • Apogen® Vloeibare Tinctuur - Spirulina Vloeibare druppels extraheren
    Apogen® Vloeibare Tinctuur

    Apogen® is het volledig natuurlijke gezondheidssupplement op basis van een formule van microalgenextracten die een "firewall" voor de gezondheid in uw lichaam creëert. Apogen is een voedingsstof waarvan wetenschappelijk is aangetoond dat deze voorkomt dat virussen cellen binnendringen. Apogen's unieke voordelen en productiemethoden worden beschermd door Amerikaanse en internationale patenten en zijn onderworpen aan grondig wetenschappelijk onderzoek. Apogenbestaat uit gezuiverde natuurlijke microalgeneiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003) en het Amerikaanse patent (US6346408) hebben aangetoond dat Apogen is effectief in de strijd tegen enterovirus 71 en influenza A, B-infecties.Apogen® Vloeibare Tinctuur is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties. De tinctuur (druppelvorm) is gunstig voor een snelle opname. Het is natuurlijk en kan dagelijks worden ingenomen zonder bijwerkingen.

  • Apogen® Capsules - Immuunboostcapsule
    Apogen® Capsules

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).Apogen® Capsules is rijk aan vitamine C en B in microalgen, helpt het metabolisme van het lichaam en houdt het fysieke evenwicht. Het ingrediënt van Spirulina, knoflookextract en bijenpropolis om je immuunsysteem te ondersteunen. Het wordt aanbevolen voor mensen die langdurig op kantoor werken, vaak in de openbare ruimte verschijnen of hoge druk en vermoeidheid hebben.

  • Apogen® Zuigtabletten 400 mg tabletten - Blauw
Spirulina Tabletten extraheren
    Apogen® Zuigtabletten 400 mg tabletten

    Apogen® Tablets is het voedingssupplement dat wordt gewonnen uit de gepatenteerde stam FEM-101 microalgen, een gezonde blauwgroene alg. Het is rijk aan antioxidanten en ontstekingsremmende eiwitten, zoals allophycocyanine (APC), C-phycocyanine (CPC), dat Spirulinagroeifactor (SGF) en polysachariden voor het versterken van de immuniteit. Het fungeert als natuurlijke brandmuur tegen griepvirussen en virale ziekteverwekkers. ApogenTabletten bestaan ​​uit gezuiverde natuurlijke microalgeneiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003) en het Amerikaanse patent (US6346408) hebben aangetoond dat Apogen® is effectief in de strijd tegen enterovirus 71 en influenza A, B-infecties.Apogen® Zuigtabletten zorgen voor langzame afgifte en coating van Apogenin de mondholte om virale infecties te voorkomen. Onze Apogen® gepatenteerde extractie kan helpen een goede gezondheid te behouden en een evenwichtige voeding aan te passen. Het is geschikt voor dagelijks gebruik, vooral tijdens de uitbraak van COVID-19 en het griepseizoen.

  • Apogen® Lactobacillus Sporogenes
Probiotica Plus - Spirulina met
    Apogen® Lactobacillus Sporogenes Probiotica Plus

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen en initiële infecties. Door onze . toe te voegen Bacillus Coagulans, Sporenvormende Lactobacillus Sporogenes heeft een hoge weerstand tegen hitte en maagzuur. Unieke formulering bevat Lactobacillus acidophilus, Bifidobacterium bifidum, Lactobacillus casei die kunnen helpen Verhoogt het immuunsysteem, allergieën verminderen en de symptomen van het prikkelbare darm syndroom verbeteren. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).

  • Apogen® Kinderkorrels - Apogen Immuunondersteuning voor kinderen
    Apogen® Kinderkorrels

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).

  • Apogen® Kauwtabletten voor kinderen - Spirulina Immuunondersteuning voor kinderen extraheren
    Apogen® Kauwtabletten voor kinderen

    Apogen® is een gepatenteerd eiwit gewonnen uit: Spirulina die een actieve stof bevat, waaronder Allophycocyanine (APC), C-phycocyanine (CPC), Spirulina groeifactor, gesulfateerd polysacharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en het is bewezen dat het het immuunsysteem ondersteunt tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, griep, respiratoir syncytieel virus en dengue-virus. Wetenschappelijke studies gepubliceerd in het Journal of Medical Virology 70:119-125 (2003).Apogen® Children Chewables is perfect voor kinderen met groeiende tanden. Het ingrediënt van DHA is gunstig voor een optimale ontwikkeling en functie van ogen en hersenen. Het zal ook het immuunsysteem van kinderen stimuleren en een gezondheidsfirewall creëren om te beschermen tegen het griepvirus. Het wordt aanbevolen voor kinderen van drie tot twaalf (3-12 jaar).

  • Apogen® Medische publicatie - Tijdschrift voor klinische geneeskunde
    Apogen® Medische publicatie

    Apogenwetenschappelijk aangetoond onderzoek bewijst dat het effectief kan helpen de natuurlijke afweer van het lichaam te ondersteunen. Het onderzoek werd gepatenteerd in de Verenigde Staten (Amerikaans patent 6346408) en Taiwanees patent (TW patent I 272947), en werd gepubliceerd in het Journal of Medical Virology 2003 70:119-125). Downloaden Apogen® Medisch publicatiedocumentbestand, vul dan het onderstaande formulier in.

Lees meer Gezondheidsvoordelen en voedingsinformatie
  • Apogen Microalgen Eiwit
    Wat is Apogen® Microalgenproteïne

  • AntiViral Remedy
    Natural Cold and Flu Remedies

    Apogen is a patented nutritional supplement concentrated and purified from proprietary strain Spirulina microalgae. A natural, healthy firewall and effective formula that medical virology has shown its antiviral properties.