ApoX Surface Anti-Viral Spray

Menu

Beste verkoop

ApoX Surface Anti-Viral Spray | Leverancier van grondstoffen en eindproducten op basis van microalgen |FEBICO

Gevestigd in Taiwan, Far East Bio-Tec Co., Ltd., sinds 1976, is een ISO-22000 en HACCP gecertificeerde Taiwanese fabrikant met meer dan 4 decennia ervaring in het produceren van op microalgen gebaseerde grondstoffen en eindproducten, waaronder Chlorella, Spirulina, Chlorella Growth Factor CGF, gepatenteerd microalgenextract, Nattokinase, Probioticaen voedingssupplementen. Afgezien van het zoeken naar distributeurs vanFEBICO merkproducten, we bieden grondstoffen, afgewerkte producten, private labeling en OEM / ODM-services.

FEBICO is de eerste Naturland / EU Organic Certified Chlorella en Spirulina producent in de wereld en de eerste fabrikant ontvangt Organische Chlorellaonder de USDA-NOP standaardcertificering. Daarnaast is het enige "Cracked Cell wall" octrooi verwerktChlorella in de wereld, zorgde voor 80% absorptie.

FEBICO biedt klanten hoogwaardige op microalgen gebaseerde grondstoffen en eindproducten, beide met geavanceerde technologie en 40 jaar ervaring, FEBICO zorgt ervoor dat aan de eisen van elke klant wordt voldaan.


ApoX Surface Anti-Viral Spray

FEBICOontwikkelt al 20 jaar antivirustechnologie, onderzoek heeft aangetoond dat ApoX-antivirale spray voor het oppervlak is samengesteld met gepatenteerde extractie van onze unieke mircoalgae FEM-101-algensoort, deze actieve ingrediënten door een beschermend membraan "virale firewall" op de huid te creëren de virusaanval weerstaan ​​en dat veel virussen er niet doorheen kunnen dringen. Het kan de influenza-virussen, enterovirussen, adenovirussen, respiratoire virussen en het eenvoudige herpesvirus type I en type II tot 24 uur effectief remmen.

Febicoaangevraagd in octrooien voor ApoX-antivirale spray voor oppervlakken in toepassingen zoals maskers, telefoons, deurknoppen en andere plaatsen die gemakkelijk met de hand toegankelijk zijn voor het publiek. ApoX-antivirale spray in een diffusor kan op de omgeving worden gespoten om de groei van virussen te remmen. ApoX vormt een beschermende laag en remt effectief de kans op infectie. Het is natuurlijk, veilig en bevat geen chemicaliën, het kan worden gebruikt voor mensen met een zwakke immuniteit, zoals kinderen of ouderen.

Antivirus spray, Anti infectie spray, Beste desinfecterende reinigingsmiddelen, Griepbestrijdende huishoudelijke schoonmaakmiddelen, Natuurlijke antivirale reinigingsmiddelen

Voordelen

  • 4 decennia professionele ervaring in microalgen technologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaars of retailers voor Febico merkproducten
  • ODM / OEM / maatwerk
  • Grondstoffen, bulkproducten, afgewerkte producten en private labeling
  • Een verscheidenheid aan verpakkingstypen
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met tijdige levering

Producteigenschappen

  • ApoX Surface antivirale spray wordt gewonnen uit onze unieke microalgen FEM-101, het is natuurlijk en kan dagelijks worden gebruikt zonder chemische toevoegingen. Het is veilig te gebruiken voor alle gezinsleden. In tegenstelling tot gewone ontsmettingsmiddelen, doodt ApoX de heilzame bacteriën op de huid niet.
  • ApoX Surface antivirale spray heeft het 'SNQ Symbol of National Quality'-keurmerk verkregen. SNQ National Quality Mark, staat voor "Safety And Quality" en wordt toegekend in samenwerking met het Institute for Biotechnology and Medicine Industry (IBMI). De kwaliteitscommissie van IBMI bestaat uit 120 meest gezaghebbende wetenschappers en gekwalificeerde experts op het gebied van voedselveiligheid en biotechnologie. Om SNQ National Quality Mark te verkrijgen, moet een product een langdurig en rigoureus peer review-proces doorlopen, waarbij de veiligheid en effectiviteit worden getest. Het SNQ National Quality Mark betekent dat Apox Antiviral Spray gecertificeerd is als effectief en veilig.
  • Natuurlijke producten, geen chemisch additief, alcoholvrij en chloride vrij, weekmaker vrij en vrij van zware metalen.
  • Ontvangen bronzen medaille voor product ter voorkoming van epidemieën op het Taiwanese symbool van nationale kwaliteit.

Belangrijke functies

  • Voorkom meerdere virussen, zoals influenza (griep A en griep B), Coxsackie A16, enterovirus, respiratoir syncytieel virus, rotavirus, adenovirus en herpesvirus type 1,2.
  • Wetenschappelijk bewezen dat ApoX-antivirale spray voor het oppervlak 99,9% kan beschermen tegen de virusaanval.
  • De langdurige effectiviteit van ApoX-antivirale spray aan het oppervlak is tot 24 uur. Spray het gewoon op telefoons, servies, toiletten, airconditioning, maskers, speelgoed en amusementsfaciliteiten om de invasie van virussen in ons lichaam te beperken. De reguliere applicatie biedt continue antivirale bescherming.
Hoofdingredient:Water, microalgenextract (Arthrospira FEM-101)
Verpakking:30 ml / fles
Aanbevolen voor (alleen uitwendig gebruik): 1. Kinderen
2. Volwassenen met een zwak immuunsysteem
3. Forenzen die dagelijks met het openbaar vervoer reizen
4. Ouderen ouder dan 65 jaar

Bedrijfsoverzicht Video



gerelateerde producten
  • Apogen® Vloeibare tinctuur - Apogen® Tinctuur
    Apogen® Vloeibare tinctuur

    Apogen® is een gepatenteerd eiwit dat wordt gewonnen uit Spirulina die actieve verbinding bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen® capsules - Apogen® capsules
    Apogen® capsules

    Apogen® is een gepatenteerd eiwit dat wordt gewonnen uit Spirulina die actieve verbinding bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen® zuigtabletten 400 mg tabletten - Apogen® zuigtabletten
    Apogen® zuigtabletten 400 mg tabletten

    Apogen® Tablets is het voedingssupplement gewonnen uit de gepatenteerde stam FEM-101 microalgen, een gezonde blauwgroene alg. Het bevat een overvloed aan antioxidanten en ontstekingsremmende eiwitten, dwz Allophycocyanine (APC), C-phycocyanine (CPC), metSpirulinagroeifactor (SGF) en polysacchariden voor het versterken van de immuniteit. Het werkt als een natuurlijke brandmuur tegen griepvirussen en virale pathogenen.ApogenTabletten bestaan ​​uit gezuiverde natuurlijke microalgen-eiwitten en nucleotide-extracten. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003) en US patent (US6346408) hebben aangetoond datApogen® is effectief in de strijd tegen enterovirus 71 en influenza A, B-infecties.


  • Apogen® Lactobacillus Sporogenes Probiotica Plus - Apogen® Lactobacillus Sporogenes Probiotica Plus
    Apogen® Lactobacillus Sporogenes Probiotica Plus

    Apogen® is een gepatenteerd eiwit dat wordt gewonnen uit Spirulina die actieve verbinding bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens immuunuitdagingen en initiële infecties. Door onze toe te voegenBacillus Coagulans, Sporenvormende Lactobacillus Sporogenes heeft een hoge weerstand tegen hitte en maagzuur. Unieke formulering bevat Lactobacillus acidophilus, Bifidobacterium bifidum, Lactobacillus casei die kunnen helpenVerhoogt het immuunsysteem, allergieën verminderen en de symptomen van het prikkelbare darm syndroom verbeteren. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen® Kindergranulaat - Apogen® Kinderen Granule
    Apogen® Kindergranulaat

    Apogen® is een gepatenteerd eiwit dat wordt gewonnen uit Spirulina die actieve verbinding bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen® Chewables voor kinderen - Apogen® Kinderen kauwbaar
    Apogen® Chewables voor kinderen

    Apogen® is een gepatenteerd eiwit dat wordt gewonnen uit Spirulina die actieve verbinding bevat, waaronder Allophycocyanin (APC), C-phycocyanin (CPC), Spirulina groeifactor, gesulfateerd polysaccharide, peptide, nucleïnezuur, aminozuren en sporenelementen. Apogen® is wetenschappelijk getest en heeft bewezen het immuunsysteem te ondersteunen tijdens immuunuitdagingen. Het beschermt u tegen een breed scala aan virale infecties, waaronder griep, enterovirus, influenza, respiratoir syncytieel virus en denguevirus. Wetenschappelijke studies gepubliceerd in Journal of Medical Virology 70: 119-125 (2003).


  • Apogen® Medische publicatie
    Apogen® Medische publicatie

    Apogenwetenschappelijk gedemonstreerd onderzoek bewijst dat het de natuurlijke afweer van het lichaam effectief kan ondersteunen. Het onderzoek werd gepatenteerd in de Verenigde Staten (Amerikaans octrooi 6346408) en Taiwanees octrooi (TW-octrooi I 272947) en werd gepubliceerd in Journal of Medical Virology 2003 70: 119-125). DownloadenApogen® Document voor medische publicatie, vul het onderstaande formulier in.



Lees meer Gezondheidsvoordelen en voedingsinformatie
  • Apogen Microalgen-eiwit
    Wat is Apogen® Microalgen Proteïne

  • AntiViral Remedy
    Natuurlijke remedies tegen verkoudheid en griep

    Apogen microalgen eiwit wordt gewonnen uit natuurlijk Spirulina. Het is in water oplosbaar, veilig in gebruik en wordt momenteel geproduceerd in verschillende soorten doseringen, waaronder tabletten of poedervorm. Het kan de mondslijmvliescellen beschermen, beschermfolies vormen en virusaanvallen voorkomen, wat het een natuurlijke remedie tegen virussen maakt en het immuunsysteem stimuleert.