Natto Complex V-Capsules

Menu

Beste verkoop

FEBICO Natto Complex V-Capsules Service Introductie

Far East Bio-Tec Co., Ltd. is Taiwan Natto Complex V-Capsules leverancier en fabrikant met meer dan 40 jaar ervaring. Sinds 1976 biedt FEBICO in de Chlorella en Spirulina (beide biologisch gecertificeerd en natuurlijk) verkrijgbaar onder het merk Febico , rauwe poeder, Febico , private labeling en OEM / ODM-diensten onze klanten een hoogwaardige Natto Complex V-Capsules productiedienst aan. Met zowel geavanceerde technologie als 40 jaar ervaring, zorgt FEBICO altijd voor de vraag van elke klant.


Natto Complex V-Capsules

Natto is een traditioneel Japans gerecht dat eenvoudig kan worden omschreven als gefermenteerde sojabonen. Aangezien Natto voedingsvitaminen en mineralen heeft, is het een van de meest populaire voedingsmiddelen in Japan. Bovendien is Natto het geheim om de Japanners te helpen een lang gezond leven te leiden. Febico Natto Complex bevat het gefermenteerde Natto-poeder (met Nattokinase ), Red Yeast Rice Powder, Astaxanthine , Co-enzym Q10 en Chlorella Powder. Het is wetenschappelijk bewezen dat het de bloedcirculatie bevordert en het risico op vorming van bloedstolsels vermindert.

Hoogwaardige Natto-extract Nattokinase capsules met Chlorella poeder / voedingssupplementen voor cardiovasculaire gezondheid

voordelen

  • 4 decennia professionele ervaring in microalgentechnologie en -cultuur
  • 140.000 M2 productiesite met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door in-house en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaren of detailhandelaren voor Febico van Febico
  • ODM / OEM / Maatwerk
  • Grondstoffen, bulkproducten, eindproducten en private labels
  • Een verscheidenheid aan keuzes van verpakkingen
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters voor testen
  • Service met tijdige levering

Producteigenschappen

  • natto:
    Fermentatieproces creëert unieke actieve ingrediënten - Natto Kinase. Natto Kinase bevordert een goede functie van de bloedcirculatie en vermijdt thrombus.
  • Rode gistrijst:
    Natuurlijk gefermenteerde rode gist bevat meerdere in water oplosbare enzymen, sterolen, isoflavonen om het metabolisme te bevorderen en de gezondheid te behouden. Fermentatieproces produceert monacoline K en γ-GABA. Monacolin K kan specifiek helpen bij een gezond metabolisme en de levensduur verlengen.
  • Astaxanthine :
    FEBICO haalt Astaxanthine uit zijn eigen rode algenstreng. Het antioxident vermogen is gelijk aan 550 keer aan vitamine E; daarom wordt Astaxanthine ook "Super Vitamine E" genoemd.
  • Co-enzym Q10:
    Het is een belangrijke factor om onze kracht en vitaliteit te behouden door het metabolisme te bevorderen en vermoeidheid te verminderen. Het is een zeer populair huidverzorgingsproduct in Japan vanwege zijn effectieve huidverlichtende vermogen.

Belangrijke functies (indicatie)

  • Hoge concentratie Natto Kinase, waarbij één tablet de suggestieve doseringen bereikt van de Japanse Natto Association: 2000 FU / dag.
  • Het fermentatieproces omvat geen chemisch of fysisch extractieproces en bevat daarom de uitgebreide voedingsstoffen en bioactiviteit van Natto-kinase en rode gistrijst.
  • Astaxanthine wordt gewonnen uit de eigen algensoort van de eigen teeltsite van FEBICO . 100% plantaardig natuurlijk en veilig voor consumptie. Niet chemisch gesynthetiseerd.
  • Natto Kinase bevordert een goede functie van de bloedcirculatie en vermijdt thrombus.
  • Fermentatieproces van rode gistrijst produceert monacoline K en K-GABA. Monacolin K kan specifiek helpen bij een gezond metabolisme en de levensduur verlengen.
  • Geslaagd SGS-test; geen medische verbinding of zware metalen gedetecteerd in het product. 100% veilig!
  • Complex regime: Natto-extract, rode gistrijst, co-enzym Q10 en Astaxanthine . Biedt het beste en uitgebreide regime voor cardiovasculaire gezondheid.
Hoofdingredient: Nattokinase , rode Astaxanthine , astaxanthine, Astaxanthine enzym Q10
verpakking: 500 mg / capsules, 90 capsules / fles
Aanbevolen voor: Kantoormedewerkers die lange uren moeten zitten
Senior of ouderlingen die cardiovasculaire gezondheid nastreven
Mensen die gebrek hebben aan lichaamsbeweging
Mensen met roken of drinken
Mensen die dol zijn op rood vleesproduct, gefrituurde of zeer gearomatiseerde producten.
Aanbevolen dosering: Normale dosering: 1 capsule / dag verbeterde dosering: 2 capsules / dag
Aandacht: 1. Kinderen onder de 15 jaar, zwangere vrouwen en vrouwen die borstvoeding geven, patiënten die Warfarin gebruiken (orale dosering anti-stollingsmiddel) moeten het advies van artsen inwinnen alvorens dit product te nemen.
2. Patiënten die op het punt staan ​​om een ​​operatie te ondergaan of na een operatie moeten de dokters raadplegen alvorens ze te gebruiken.
gerelateerde producten
  • Chlorella Sorokina® PPAR-tabletten - FEBICO Sorokina PPAR-tabletten
    Chlorella Sorokina® PPAR-tabletten

    Sorokina PPAR-tabletten is een combinatie van 3 voor Chlorella Sorokiniana, FEM-101 Spirulina en Schizochytrium sp (DHA-algen). Sorokina PPAR-tabletten is een natuurlijke vitamine die rijk is aan eiwitten, hoge voedingsvezels, fytochemicaliën (bèta-caroteen, phycocyanine, chlorofyl), 9 mineralen, 12 vitaminen, 18 aminozuren, groeifactoren, onverzadigde vetzuren (GLA, DHA, EPA, ARA) . Het zorgt voor energie voor een dag via een uitgebreide lijst met voedingsstoffen.


  • CV-66 Chlorella Vulgaris - FEBICO CV-66 Vulgaris
    CV-66 Chlorella Vulgaris

    De belangrijkste functies van Vulgaris CV-66 zijn goedgekeurd en gecertificeerd door het Taiwanese ministerie van Volksgezondheid (nummer A00146). Het heeft wetenschappelijk significante effecten aangetoond voor het metabool syndroom en het bloedtriglycerideniveau aangepast. Bevat meer dan 20 vitamines en mineralen, waaronder B-complex, beta-caroteen, vitamine C en E, ijzer en calcium. Het is de hoogste bron van chlorofyl, een leverontgifter, een darmreiniger en een opname van andere elementen, waaronder ijzer. Het is de hoogste bron van het DNA en RNA van de nucleïnezuren, waarvan wordt verondersteld dat verminderde niveaus betrokken zijn bij fysieke achteruitgang en veroudering.



Lees meer Gezondheidsvoordelen en voedingswaarde-informatie
  • Cardiovasculaire gezondheid
    Cardiovasculaire gezondheid en hartslag

    Door FEBICO Natto Complex regelmatig in te nemen, kunnen hartaandoeningen, hartinfarcten en de ziekte van Alzheimer worden voorkomen. Bloedcirculatie Gezondheid] Assisteren met Bloedcirculatie, om het risico op vorming van bloedstolsels te verminderen.