Natto Complex V-capsules

Menu

Beste verkoop

Natto Complex V-capsules | Leverancier van grondstoffen en eindproducten op basis van microalgen | FEBICO

Far East Bio-Tec Co., Ltd. , gevestigd in Taiwan, is sinds 1976 een ISO-22000 en HACCP gecertificeerde Taiwanese fabrikant met meer dan 4 decennia ervaring in het produceren van op microalgen gebaseerde grondstoffen en eindproducten, waaronder Chlorella , Spirulina , Chlorella groeifactor CGF, gepatenteerd microalgenextract, Nattokinase , Probiotica en voedingssupplementen. Naast het zoeken naar distributeurs van FEBICO merkproducten, bieden we ook grondstoffen, afgewerkte producten, private labeling en OEM / ODM-services.

FEBICO is de eerste Naturland / EU Organic Certified Chlorella en Spirulina producent ter wereld en de eerste fabrikant ontvangt Organische Chlorella onder de USDA-NOP-standaardcertificering. Bovendien zorgde het enige octrooi met "Cracked Cell Wall" Chlorella ter wereld voor 80% absorptie.

FEBICO biedt klanten hoogwaardige op microalgen gebaseerde grondstoffen en eindproducten, beide met geavanceerde technologie en 40 jaar ervaring, FEBICO zorgt ervoor dat aan de eisen van elke klant wordt voldaan.


Natto Complex V-capsules

Natto is een traditioneel Japans gerecht dat eenvoudig kan worden gedefinieerd als gefermenteerde sojabonen. Omdat Natto voedingsvitaminen en mineralen heeft, is het een van de meest populaire voedingsmiddelen in Japan. Bovendien is Natto het geheim om Japanners te helpen een lang en gezond leven te leiden. Febico Natto Complex bevat het gefermenteerde Natto-poeder (met Nattokinase ), rode gistrijstpoeder, Astaxanthine , co-enzym Q10 en Chlorella . Het is wetenschappelijk bewezen dat het de bloedcirculatie bevordert en het risico op vorming van bloedstolsels vermindert.

Nattokinase capsules, vitamine K2, rode gistrijst, pure Nattokinase

Voordelen

  • 4 decennia professionele ervaring in microalgen technologie en teelt
  • 140.000 M2 productielocatie met een jaarlijkse capaciteit van microalgen> 1000 ton
  • Innovatief en gespecialiseerd R & D-team
  • Internationale kwaliteitssysteemcertificeringen: ISO22000 en HACCP
  • Productveiligheid geverifieerd door interne en externe laboratoria

Diensten

  • Op zoek naar distributeurs, groothandelaars of detailhandelaars voor Febico merk Febico
  • ODM / OEM / maatwerk
  • Grondstoffen, bulkproducten, afgewerkte producten en private labeling
  • Een verscheidenheid aan verpakkingstypen
  • Technische ondersteuning en grafisch ontwerp
  • Gratis monsters om te testen
  • Service met tijdige levering

Producteigenschappen

  • Natto:
    Het fermentatieproces creëert unieke actieve ingrediënten - Natto Kinase. Natto Kinase bevordert de goede werking van de bloedcirculatie en vermijdt trombus.
  • Rode gistrijst:
    Natuurlijk gefermenteerde rode gist bevat meerdere in water oplosbare enzymen, sterolen, isoflavoneningrediënten om de stofwisseling te bevorderen en de gezondheid te behouden. Fermentatieproces produceert monacolin K en γ-GABA. Monacolin K kan specifiek helpen bij een gezond metabolisme en de levensduur verlengen.
  • Astaxanthine :
    FEBICO haalt Astaxanthine uit zijn eigen rode algenstreng. Het antioxidentievermogen is gelijk aan 550 keer vitamine E; daarom wordt Astaxanthine ook wel “Super Vitamine E” genoemd.
  • Co-enzym Q10:
    Het is een belangrijke factor om onze vitaliteit en vitaliteit te behouden door het metabolisme te bevorderen en vermoeidheid te verminderen. Het is een zeer populair huidverzorgingsproduct in Japan vanwege het effectieve huidverlichtende vermogen.

Belangrijke functies

  • Hoge concentratie Natto Kinase, waarbij één tablet de suggestieve doseringen van de Japanse Natto Association bereikte: 2000 FU / dag.
  • Het fermentatieproces omvat geen chemisch of fysisch extractieproces en bevat daarom de uitgebreide voedingsstoffen en bioactiviteit van Natto-kinase en rode gistrijst.
  • Astaxanthine wordt gewonnen uit de gepatenteerde algenstreng van FEBICO 's eigen FEBICO . 100% plantaardig natuurlijk en veilig voor consumptie. Niet chemisch gesynthetiseerd.
  • Natto Kinase bevordert de goede werking van de bloedcirculatie en vermijdt trombus.
  • Het fermentatieproces van rode gistrijst produceert monacolin K en K-GABA. Monacolin K kan specifiek helpen bij een gezond metabolisme en de levensduur verlengen.
  • Geslaagd SGS-test; geen medische verbinding of zwaar metaal gedetecteerd in het product. 100% veilig!
  • Complex regime: Natto-extract, rode gistrijst, co-enzym Q10 en Astaxanthine . Biedt het beste en uitgebreide regime voor cardiovasculaire gezondheid.
Hoofdingredient: Nattokinase , Nattokinase rode rijst, Astaxanthine , co-enzym Q10
Verpakking: 500 mg / capsules, 90 capsules / fles
Aanbevolen voor: Kantoormedewerkers die lange uren nodig hebben
Senior of ouderlingen die cardiovasculaire gezondheid nastreven
Mensen die weinig bewegen
Mensen met roken of drinken
Mensen die graag rood vlees eten, gebakken of producten met een hoge smaak.
Aanbevolen dosering: Normale dosering: 1 capsule / dag versterkte dosering: 2 capsules / dag
Aandacht: 1. Kinderen jonger dan 15 jaar, zwangere vrouwen en vrouwen die borstvoeding geven, patiënten die Warfarine gebruiken (orale dosering anticoagulantia), moeten een arts raadplegen alvorens dit product in te nemen.
2. Patiënten die op het punt staan ​​een operatie te ondergaan of na een operatie, moeten voor gebruik een arts raadplegen.
gerelateerde producten
  • Sorokina® PPARs 200 mg tabletten - FEBICO Sorokina PPAR-tabletten
    Sorokina® PPARs 200 mg tabletten

    Sorokina PPAR-tabletten zijn 3 combinaties voor Chlorella Sorokiniana, FEM-101 Spirulina en Schizochytrium sp (DHA-algen). Sorokina PPAR-tabletten is een natuurlijke vitamine die rijk is aan eiwitten, veel voedingsvezels, fytochemicaliën (bètacaroteen, fycocyanine, chlorofyl), 9 mineralen, 12 vitamines, 18 aminozuren, groeifactoren, onverzadigde vetzuren (GLA, DHA, EPA, ARA) . Het levert energie die een dag meegaat via een uitgebreide lijst van voedingsstoffen.


  • CV-66 Chlorella Vulgaris-tabletten - FEBICO CV-66 Vulgaris
    CV-66 Chlorella Vulgaris-tabletten

    De belangrijkste functies van Vulgaris CV-66 zijn goedgekeurd en gecertificeerd door het Taiwanese ministerie van Volksgezondheid (nr. A00146). Het heeft wetenschappelijk significante effecten voor het metabool syndroom aangetoond en het triglyceridengehalte in het bloed aangepast. Bevat meer dan 20 vitamines en mineralen waaronder B-complex, bètacaroteen, vitamine C en E, ijzer en calcium. Het is de hoogste bron van chlorofyl, een leverontgifter, een darmreiniger en een opname van andere elementen, waaronder ijzer. Het is de hoogste bron van het nucleïnezuur DNA en RNA, waarvan wordt aangenomen dat verlaagde niveaus betrokken zijn bij fysieke achteruitgang en veroudering.



Lees meer Gezondheidsvoordelen en voedingsinformatie
  • Cardiovasculaire gezondheid
    Cardiovasculaire gezondheid en hartaanval

    Het regelmatig FEBICO Natto Complex kan hartaandoeningen, myocardinfarct en de ziekte van Alzheimer voorkomen. Blood Circulation Health] Helpt bij bloedcirculatie, om het risico op vorming van bloedstolsels te verminderen.